Class b: All beta proteins [48724] (180 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.0: automated matches [191560] (1 protein) not a true family |
Protein automated matches [190967] (36 species) not a true protein |
Species Brucella abortus [TaxId:430066] [237007] (2 PDB entries) |
Domain d4hzch_: 4hzc H: [240230] automated match to d4hzcc_ complexed with 15p, cl, mg, trs |
PDB Entry: 4hzc (more details), 1.97 Å
SCOPe Domain Sequences for d4hzch_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hzch_ b.81.1.0 (H:) automated matches {Brucella abortus [TaxId: 430066]} vdpiwhsiraeaeeatrndpvlgaflyatilnqpsleeavmhriaerlghpdvsadilrq tfdtmleanpewshvlrvdiqavydrdpaysrfmdpvlylkgfhaiqthrlahwlykqgr kdfayylqsrsssifqtdihpaarlgsglfldhatglvvgetavvednvsilhgvtlggt gkssgdrhpkirqgvligagakilgniqvgqcskiaagsvvlksvphnvtvagvpariig etgct
Timeline for d4hzch_: