Lineage for d4hzcf_ (4hzc F:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2079733Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2079734Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2080029Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 2080030Protein automated matches [190967] (30 species)
    not a true protein
  7. 2080066Species Brucella abortus [TaxId:430066] [237007] (2 PDB entries)
  8. 2080074Domain d4hzcf_: 4hzc F: [240228]
    automated match to d4hzcc_
    complexed with 15p, cl, mg, trs

Details for d4hzcf_

PDB Entry: 4hzc (more details), 1.97 Å

PDB Description: crystal structure of serine acetyltransferase from brucella abortus strain s19
PDB Compounds: (F:) CysE, serine acetyltransferase

SCOPe Domain Sequences for d4hzcf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hzcf_ b.81.1.0 (F:) automated matches {Brucella abortus [TaxId: 430066]}
vdpiwhsiraeaeeatrndpvlgaflyatilnqpsleeavmhriaerlghpdvsadilrq
tfdtmleanpewshvlrvdiqavydrdpaysrfmdpvlylkgfhaiqthrlahwlykqgr
kdfayylqsrsssifqtdihpaarlgsglfldhatglvvgetavvednvsilhgvtlggt
gkssgdrhpkirqgvligagakilgniqvgqcskiaagsvvlksvphnvtvagvpariig
etgct

SCOPe Domain Coordinates for d4hzcf_:

Click to download the PDB-style file with coordinates for d4hzcf_.
(The format of our PDB-style files is described here.)

Timeline for d4hzcf_: