Lineage for d4hr7i_ (4hr7 I:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2426781Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2426782Superfamily b.84.1: Single hybrid motif [51230] (2 families) (S)
    7 to 8 strands in 2 beta-sheets
  5. 2426783Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins)
  6. 2426853Protein automated matches [254572] (2 species)
    not a true protein
  7. 2426854Species Escherichia coli K-12 [TaxId:83333] [255326] (2 PDB entries)
  8. 2426858Domain d4hr7i_: 4hr7 I: [240224]
    Other proteins in same PDB: d4hr7a1, d4hr7a2, d4hr7a3, d4hr7c1, d4hr7c2, d4hr7c3, d4hr7e1, d4hr7e2, d4hr7e3, d4hr7f1, d4hr7f2, d4hr7f3
    automated match to d1a6xa_
    complexed with edo, so4

Details for d4hr7i_

PDB Entry: 4hr7 (more details), 2.5 Å

PDB Description: Crystal Structure of Biotin Carboxyl Carrier Protein-Biotin Carboxylase Complex from E.coli
PDB Compounds: (I:) Biotin carboxyl carrier protein of acetyl-CoA carboxylase

SCOPe Domain Sequences for d4hr7i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hr7i_ b.84.1.1 (I:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
ghivrspmvgtfyrtpspdakafievgqkvnvgdtlciveamkmmnqieadksgtvkail
vesgqpvefdeplvvie

SCOPe Domain Coordinates for d4hr7i_:

Click to download the PDB-style file with coordinates for d4hr7i_.
(The format of our PDB-style files is described here.)

Timeline for d4hr7i_: