| Class b: All beta proteins [48724] (180 folds) |
| Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.1: Single hybrid motif [51230] (2 families) ![]() 7 to 8 strands in 2 beta-sheets |
| Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins) |
| Protein automated matches [254572] (2 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [255326] (2 PDB entries) |
| Domain d4hr7i_: 4hr7 I: [240224] Other proteins in same PDB: d4hr7a1, d4hr7a2, d4hr7a3, d4hr7c1, d4hr7c2, d4hr7c3, d4hr7e1, d4hr7e2, d4hr7e3, d4hr7f1, d4hr7f2, d4hr7f3 automated match to d1a6xa_ complexed with edo, so4 |
PDB Entry: 4hr7 (more details), 2.5 Å
SCOPe Domain Sequences for d4hr7i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hr7i_ b.84.1.1 (I:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
ghivrspmvgtfyrtpspdakafievgqkvnvgdtlciveamkmmnqieadksgtvkail
vesgqpvefdeplvvie
Timeline for d4hr7i_: