Lineage for d4hn8g1 (4hn8 G:155-463)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2837252Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2837253Protein automated matches [226923] (79 species)
    not a true protein
  7. 2837703Species Pseudomonas mendocina [TaxId:399739] [234660] (1 PDB entry)
  8. 2837710Domain d4hn8g1: 4hn8 G:155-463 [240218]
    Other proteins in same PDB: d4hn8a1, d4hn8b1, d4hn8c1, d4hn8d1, d4hn8h1
    automated match to d4hn8a2
    complexed with gol

Details for d4hn8g1

PDB Entry: 4hn8 (more details), 2.2 Å

PDB Description: crystal structure of a putative d-glucarate dehydratase from pseudomonas mendocina ymp
PDB Compounds: (G:) d-glucarate dehydratase

SCOPe Domain Sequences for d4hn8g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hn8g1 c.1.11.0 (G:155-463) automated matches {Pseudomonas mendocina [TaxId: 399739]}
sgqqrqrvpmlaylfyigerqradlpylagkgsaddwyhlrhqaaltpdaiarlaeaara
rygfadfklkggvmrgaeemeairaikarfpdarvtldpngawsldeaialckgqghvla
yaedpcgpengysgrevmaefkratgiptatnmvatdwrqmghslrleavdipladphfw
tmqgavrlgqvceefgltwgshsnnhfdislamfthaaaavpgritaidthwiwqegeer
ltreplrivggqvqvpdkpglgiepdmqrimaahelykkvasgarddamamqylvpgwqy
hpkrpslgr

SCOPe Domain Coordinates for d4hn8g1:

Click to download the PDB-style file with coordinates for d4hn8g1.
(The format of our PDB-style files is described here.)

Timeline for d4hn8g1: