| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
| Protein automated matches [226923] (71 species) not a true protein |
| Species Pseudomonas mendocina [TaxId:399739] [234660] (1 PDB entry) |
| Domain d4hn8e1: 4hn8 E:155-463 [240216] Other proteins in same PDB: d4hn8a1, d4hn8b1, d4hn8c1, d4hn8d1, d4hn8h1 automated match to d4hn8a2 complexed with gol |
PDB Entry: 4hn8 (more details), 2.2 Å
SCOPe Domain Sequences for d4hn8e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hn8e1 c.1.11.0 (E:155-463) automated matches {Pseudomonas mendocina [TaxId: 399739]}
sgqqrqrvpmlaylfyigerqradlpylagkgsaddwyhlrhqaaltpdaiarlaeaara
rygfadfklkggvmrgaeemeairaikarfpdarvtldpngawsldeaialckgqghvla
yaedpcgpengysgrevmaefkratgiptatnmvatdwrqmghslrleavdipladphfw
tmqgavrlgqvceefgltwgshsnnhfdislamfthaaaavpgritaidthwiwqegeer
ltreplrivggqvqvpdkpglgiepdmqrimaahelykkvasgarddamamqylvpgwqy
hpkrpslgr
Timeline for d4hn8e1: