SCOPe 2.06: Domain d4hjjl3: 4hjj L:223-327

Lineage for d4hjjl3 (4hjj L:223-327)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d4hjjl3: 4hjj L:223-327 [240208]
   Other proteins in same PDB: d4hjja1, d4hjja2
   complexed with cl, gol, so4

Details for d4hjjl3

PDB Entry: 4hjj, 2.1 Å

PDB Description: Structure Reveals Function of the Dual Variable Domain Immunoglobulin (DVD-Ig) Molecule

PDB Compounds: (L:) Anti-IL12 Anti-IL18 DFab Light Chain

SCOPe Domain Sequences for d4hjjl3:

Sequence; same for both SEQRES and ATOM records:

>d4hjjl3 b.1.1.0 (L:223-327) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqds
kdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d4hjjl3:

• d4hjjl3 first appeared in SCOPe 2.04
  
• d4hjjl3 appears in SCOPe 2.05
  
• d4hjjl3 appears in SCOPe 2.07
  
• d4hjjl3 appears in the current release, SCOPe 2.08