Class b: All beta proteins [48724] (177 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.1: Sialidases [50939] (3 families) |
Family b.68.1.0: automated matches [191452] (1 protein) not a true family |
Protein automated matches [190692] (15 species) not a true protein |
Species Enterobacteria phage [TaxId:948870] [236008] (1 PDB entry) |
Domain d4hizc1: 4hiz C:102-603 [240204] Other proteins in same PDB: d4hiza2, d4hizb2, d4hizc2 automated match to d4hiza1 complexed with ca, cl, edo, mg, na, suc |
PDB Entry: 4hiz (more details), 1.6 Å
SCOPe Domain Sequences for d4hizc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hizc1 b.68.1.0 (C:102-603) automated matches {Enterobacteria phage [TaxId: 948870]} dgrnltfkvttlpdiskfknaafvyerivgqpltyvsegffdgnltkitdtpfynawtqd ktfvydnviyapfmagerhgvqnlhvawvksgddgqtwsmpewltpihpdytadkvnyhc msmgvcgnrlyavietrylsnmrlkkaelwsrpmpyyrrptggitissgsttativlkkh glkvgdavnfsnsgatgvsgnmtvasvinkdtftvtlaraatsnidntgttwhfgtrfwd spweitelpdvaystnadlcvtethsftvidddnytfavgyhngdisprrlgilyfnnay sdpssftrrtisqeyadnaaepcikyydgilylttrgtstsaagstlamsadlgenwnyl rfpnnvhhtnlpfakvgdylyifgtersfgewegqeldnrykgtyprtfmckinvsswpv slsnvqwfnitdqiyqghivnsacgvgsvcvkdgwlyyifggedflspwsigdnskklwy khdghpadlysyrlkitehdfv
Timeline for d4hizc1:
View in 3D Domains from other chains: (mouse over for more information) d4hiza1, d4hiza2, d4hizb1, d4hizb2 |