Lineage for d4hizc1 (4hiz C:102-603)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2398193Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2398194Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2398637Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. 2398638Protein automated matches [190692] (14 species)
    not a true protein
  7. 2398639Species Enterobacteria phage [TaxId:948870] [236008] (1 PDB entry)
  8. 2398642Domain d4hizc1: 4hiz C:102-603 [240204]
    Other proteins in same PDB: d4hiza2, d4hizb2, d4hizc2
    automated match to d4hiza1
    complexed with ca, cl, edo, mg, na, sia, slb, suc

Details for d4hizc1

PDB Entry: 4hiz (more details), 1.6 Å

PDB Description: phage phi92 endosialidase
PDB Compounds: (C:) Endosialidase

SCOPe Domain Sequences for d4hizc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hizc1 b.68.1.0 (C:102-603) automated matches {Enterobacteria phage [TaxId: 948870]}
dgrnltfkvttlpdiskfknaafvyerivgqpltyvsegffdgnltkitdtpfynawtqd
ktfvydnviyapfmagerhgvqnlhvawvksgddgqtwsmpewltpihpdytadkvnyhc
msmgvcgnrlyavietrylsnmrlkkaelwsrpmpyyrrptggitissgsttativlkkh
glkvgdavnfsnsgatgvsgnmtvasvinkdtftvtlaraatsnidntgttwhfgtrfwd
spweitelpdvaystnadlcvtethsftvidddnytfavgyhngdisprrlgilyfnnay
sdpssftrrtisqeyadnaaepcikyydgilylttrgtstsaagstlamsadlgenwnyl
rfpnnvhhtnlpfakvgdylyifgtersfgewegqeldnrykgtyprtfmckinvsswpv
slsnvqwfnitdqiyqghivnsacgvgsvcvkdgwlyyifggedflspwsigdnskklwy
khdghpadlysyrlkitehdfv

SCOPe Domain Coordinates for d4hizc1:

Click to download the PDB-style file with coordinates for d4hizc1.
(The format of our PDB-style files is described here.)

Timeline for d4hizc1: