Lineage for d4hgmb3 (4hgm B:389-492)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1748371Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 1748372Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 1748373Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 1748374Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. 1748375Species Human (Homo sapiens) [TaxId:9606] [48555] (70 PDB entries)
    Uniprot P02768 29-596
  8. 1748405Domain d4hgmb3: 4hgm B:389-492 [240203]
    Other proteins in same PDB: d4hgma_
    complexed with ace, edo

Details for d4hgmb3

PDB Entry: 4hgm (more details), 2.34 Å

PDB Description: shark ignar variable domain
PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d4hgmb3:

Sequence, based on SEQRES records: (download)

>d4hgmb3 a.126.1.1 (B:389-492) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsale

Sequence, based on observed residues (ATOM records): (download)

>d4hgmb3 a.126.1.1 (B:389-492) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeyqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpcae
dylsvvlnqlcvlhektpvsdrvtkccslvnrrpcfsale

SCOPe Domain Coordinates for d4hgmb3:

Click to download the PDB-style file with coordinates for d4hgmb3.
(The format of our PDB-style files is described here.)

Timeline for d4hgmb3:

View in 3D
Domains from other chains:
(mouse over for more information)
d4hgma_