| Class b: All beta proteins [48724] (178 folds) |
| Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) ![]() |
| Family b.21.1.3: Lactophage receptor-binding protein head domain [141122] (3 proteins) automatically mapped to Pfam PF08932 |
| Protein automated matches [232461] (1 species) not a true protein |
| Species Lactococcus phage [TaxId:35345] [232462] (6 PDB entries) |
| Domain d4hepa2: 4hep A:63-163 [240201] Other proteins in same PDB: d4hepa1, d4hepg_ automated match to d2f0ca1 complexed with so4 |
PDB Entry: 4hep (more details), 1.75 Å
SCOPe Domain Sequences for d4hepa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hepa2 b.21.1.3 (A:63-163) automated matches {Lactococcus phage [TaxId: 35345]}
ptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcslv
ghmvggwnafhidipssgvcqwfgptassgtprgtgtypid
Timeline for d4hepa2: