Lineage for d4hepa2 (4hep A:63-163)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778904Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 1778905Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 1779071Family b.21.1.3: Lactophage receptor-binding protein head domain [141122] (3 proteins)
    automatically mapped to Pfam PF08932
  6. 1779088Protein automated matches [232461] (1 species)
    not a true protein
  7. 1779089Species Lactococcus phage [TaxId:35345] [232462] (6 PDB entries)
  8. 1779093Domain d4hepa2: 4hep A:63-163 [240201]
    Other proteins in same PDB: d4hepa1, d4hepg_
    automated match to d2f0ca1
    complexed with so4

Details for d4hepa2

PDB Entry: 4hep (more details), 1.75 Å

PDB Description: complex of lactococcal phage tp901-1 with a llama vhh (vhh17) binder (nanobody)
PDB Compounds: (A:) bpp

SCOPe Domain Sequences for d4hepa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hepa2 b.21.1.3 (A:63-163) automated matches {Lactococcus phage [TaxId: 35345]}
ptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcslv
ghmvggwnafhidipssgvcqwfgptassgtprgtgtypid

SCOPe Domain Coordinates for d4hepa2:

Click to download the PDB-style file with coordinates for d4hepa2.
(The format of our PDB-style files is described here.)

Timeline for d4hepa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hepa1
View in 3D
Domains from other chains:
(mouse over for more information)
d4hepg_