SCOPe 2.08: Domain d4hepa1: 4hep A:2-62

Lineage for d4hepa1 (4hep A:2-62)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.108: Triple-stranded beta-helix [69348] (1 superfamily)
   (homo)trimer; each chain donates 3 beta-strands per turn of the helix

4. Superfamily b.108.1: Phage fibre proteins [69349] (6 families)

5. Family b.108.1.0: automated matches [231970] (1 protein)
   not a true family

6. Protein automated matches [231971] (3 species)
   not a true protein

7. Species Lactococcus phage [TaxId:35345] [231972] (5 PDB entries)

8. Domain d4hepa1: 4hep A:2-62 [240200]
   Other proteins in same PDB: d4hepa2, d4hepg_
   automated match to d2f0ca2
   complexed with so4

Details for d4hepa1

PDB Entry: 4hep, 1.75 Å

PDB Description: complex of lactococcal phage tp901-1 with a llama vhh (vhh17) binder (nanobody)

PDB Compounds: (A:) bpp

SCOPe Domain Sequences for d4hepa1:

Sequence; same for both SEQRES and ATOM records:

>d4hepa1 b.108.1.0 (A:2-62) automated matches {Lactococcus phage [TaxId: 35345]}
asikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngslt
l

Timeline for d4hepa1:

• d4hepa1 first appeared in SCOPe 2.04
  
• d4hepa1 appears in SCOPe 2.07