Lineage for d4h88l2 (4h88 L:108-213)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1763627Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)
  8. 1763705Domain d4h88l2: 4h88 L:108-213 [240197]
    Other proteins in same PDB: d4h88a_, d4h88l1
    automated match to d4dgil2
    complexed with na

Details for d4h88l2

PDB Entry: 4h88 (more details), 1.9 Å

PDB Description: Structure of POM1 FAB fragment complexed with mouse PrPc Fragment 120-230
PDB Compounds: (L:) pom1 fab chain l

SCOPe Domain Sequences for d4h88l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h88l2 b.1.1.2 (L:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnsetdqd
skdstysmsstltltkdeyerhntytceathktstspivksfnrne

SCOPe Domain Coordinates for d4h88l2:

Click to download the PDB-style file with coordinates for d4h88l2.
(The format of our PDB-style files is described here.)

Timeline for d4h88l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4h88l1
View in 3D
Domains from other chains:
(mouse over for more information)
d4h88a_