Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.41: Subtilisin-like [52742] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3 |
Superfamily c.41.1: Subtilisin-like [52743] (3 families) |
Family c.41.1.0: automated matches [191390] (1 protein) not a true family |
Protein automated matches [190500] (7 species) not a true protein |
Species Planktothrix agardhii [TaxId:443922] [234618] (1 PDB entry) |
Domain d4h6wb_: 4h6w B: [240195] automated match to d4h6wa_ |
PDB Entry: 4h6w (more details), 2.45 Å
SCOPe Domain Sequences for d4h6wb_:
Sequence, based on SEQRES records: (download)
>d4h6wb_ c.41.1.0 (B:) automated matches {Planktothrix agardhii [TaxId: 443922]} ipglkklwsetrgdpkicvavldgivdqnhpcfigadltrlpslvsgeanangsmsthgt hvasiifgqhdspvtgiapqcrglivpvfadeslklsqldlsraieqavnnganiinvsa gqltdageadtwlekaiqlcqennvlliaatgndgceclhvpaslptvlavgamddqgkp vdfsnwgdayqkqgilapgkdilgakpnggtirlsgtsfatpivsgvaalllslqikrge kpdpqkvknallasatpcnpkdtddqsrclmgklnildaiehltg
>d4h6wb_ c.41.1.0 (B:) automated matches {Planktothrix agardhii [TaxId: 443922]} ipglkklwsetrgdpkicvavldgivdqnhpcfigadltrlpssmsthgthvasiifgqh dspvtgiapqcrglivpvfadeslklsqldlsraieqavnnganiinvsagqltdagead twlekaiqlcqennvlliaatgndgceclhvpaslptvlavgamddqgkpvdfsnwgday qkqgilapgkdilgakpnggtirlsgtsfatpivsgvaalllslqikrgekpdpqkvkna llasatpcnpkdtddqsrclmgklnildaiehltg
Timeline for d4h6wb_: