Lineage for d4h6wb_ (4h6w B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114950Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2114951Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2115291Family c.41.1.0: automated matches [191390] (1 protein)
    not a true family
  6. 2115292Protein automated matches [190500] (8 species)
    not a true protein
  7. 2115305Species Planktothrix agardhii [TaxId:443922] [234618] (1 PDB entry)
  8. 2115307Domain d4h6wb_: 4h6w B: [240195]
    automated match to d4h6wa_

Details for d4h6wb_

PDB Entry: 4h6w (more details), 2.45 Å

PDB Description: structure of prenylagaramide maturation protease paga
PDB Compounds: (B:) N-terminal cyanobactin protease

SCOPe Domain Sequences for d4h6wb_:

Sequence, based on SEQRES records: (download)

>d4h6wb_ c.41.1.0 (B:) automated matches {Planktothrix agardhii [TaxId: 443922]}
ipglkklwsetrgdpkicvavldgivdqnhpcfigadltrlpslvsgeanangsmsthgt
hvasiifgqhdspvtgiapqcrglivpvfadeslklsqldlsraieqavnnganiinvsa
gqltdageadtwlekaiqlcqennvlliaatgndgceclhvpaslptvlavgamddqgkp
vdfsnwgdayqkqgilapgkdilgakpnggtirlsgtsfatpivsgvaalllslqikrge
kpdpqkvknallasatpcnpkdtddqsrclmgklnildaiehltg

Sequence, based on observed residues (ATOM records): (download)

>d4h6wb_ c.41.1.0 (B:) automated matches {Planktothrix agardhii [TaxId: 443922]}
ipglkklwsetrgdpkicvavldgivdqnhpcfigadltrlpssmsthgthvasiifgqh
dspvtgiapqcrglivpvfadeslklsqldlsraieqavnnganiinvsagqltdagead
twlekaiqlcqennvlliaatgndgceclhvpaslptvlavgamddqgkpvdfsnwgday
qkqgilapgkdilgakpnggtirlsgtsfatpivsgvaalllslqikrgekpdpqkvkna
llasatpcnpkdtddqsrclmgklnildaiehltg

SCOPe Domain Coordinates for d4h6wb_:

Click to download the PDB-style file with coordinates for d4h6wb_.
(The format of our PDB-style files is described here.)

Timeline for d4h6wb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4h6wa_