Lineage for d4h32j_ (4h32 J:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3041028Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)
  8. 3041220Domain d4h32j_: 4h32 J: [240193]
    Other proteins in same PDB: d4h32a1, d4h32a2, d4h32c1, d4h32c2, d4h32e1, d4h32e2, d4h32g1, d4h32g2, d4h32i1, d4h32i2, d4h32k1, d4h32k2
    automated match to d1rd8b_
    complexed with nag

Details for d4h32j_

PDB Entry: 4h32 (more details), 2.7 Å

PDB Description: the crystal structure of the hemagglutinin h17 derived the bat influenza a virus
PDB Compounds: (J:) Hemagglutinin

SCOPe Domain Sequences for d4h32j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h32j_ h.3.1.1 (J:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
agfieggwqgmidgwygyhhenqegsgyaadkeatqkavdaitnkvnsiidkmnsqfesn
ikefnrlelriqhlsdrvddalldiwsyntellvllenertldfhdanvknlfekvkaql
kdnaidegngcflllhkcnnscmddikngtykymdyreeshiekqkidgve

SCOPe Domain Coordinates for d4h32j_:

Click to download the PDB-style file with coordinates for d4h32j_.
(The format of our PDB-style files is described here.)

Timeline for d4h32j_: