Lineage for d4h2hg2 (4h2h G:126-367)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2837252Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2837253Protein automated matches [226923] (79 species)
    not a true protein
  7. 2837680Species Pelagibaca bermudensis [TaxId:314265] [234604] (1 PDB entry)
  8. 2837687Domain d4h2hg2: 4h2h G:126-367 [240186]
    Other proteins in same PDB: d4h2ha1, d4h2ha3, d4h2hb1, d4h2hb3, d4h2hc1, d4h2hc3, d4h2hd1, d4h2hd3, d4h2he1, d4h2he3, d4h2hf1, d4h2hf3, d4h2hg1, d4h2hg3, d4h2hh1, d4h2hh3
    automated match to d4h2ha2
    complexed with 0xw, iod, mg, mpd, ni

Details for d4h2hg2

PDB Entry: 4h2h (more details), 1.7 Å

PDB Description: Crystal structure of an enolase (mandalate racemase subgroup, target EFI-502101) from Pelagibaca bermudensis htcc2601, with bound mg and l-4-hydroxyproline betaine (betonicine)
PDB Compounds: (G:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d4h2hg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h2hg2 c.1.11.0 (G:126-367) automated matches {Pelagibaca bermudensis [TaxId: 314265]}
altdsvssyyslgvmepdeaarqalekqregysrlqvklgarpieidieairkvweavrg
tgialaadgnrgwttrdalrfsrecpdipfvmeqpcnsfedleairplchhalymdedgt
slntvitaaatslvdgfgmkvsrigglqhmrafrdfcaarnlphtcddawggdivsaact
hiastvlprlmegawlaqpyvaehydaengvrieggrirvpqgpglgltidperfgpplf
sa

SCOPe Domain Coordinates for d4h2hg2:

Click to download the PDB-style file with coordinates for d4h2hg2.
(The format of our PDB-style files is described here.)

Timeline for d4h2hg2: