| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
| Protein automated matches [226923] (71 species) not a true protein |
| Species Pelagibaca bermudensis [TaxId:314265] [234604] (1 PDB entry) |
| Domain d4h2hf2: 4h2h F:126-367 [240184] Other proteins in same PDB: d4h2ha1, d4h2hb1, d4h2hc1, d4h2hd1, d4h2he1, d4h2hf1, d4h2hg1, d4h2hh1 automated match to d4h2ha2 complexed with 0xw, iod, mg, mpd, ni |
PDB Entry: 4h2h (more details), 1.7 Å
SCOPe Domain Sequences for d4h2hf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h2hf2 c.1.11.0 (F:126-367) automated matches {Pelagibaca bermudensis [TaxId: 314265]}
altdsvssyyslgvmepdeaarqalekqregysrlqvklgarpieidieairkvweavrg
tgialaadgnrgwttrdalrfsrecpdipfvmeqpcnsfedleairplchhalymdedgt
slntvitaaatslvdgfgmkvsrigglqhmrafrdfcaarnlphtcddawggdivsaact
hiastvlprlmegawlaqpyvaehydaengvrieggrirvpqgpglgltidperfgpplf
sa
Timeline for d4h2hf2: