Lineage for d4gyvi1 (4gyv I:536-746)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004752Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
    multihelical; core: 5-helical bundle
  4. 2004753Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families) (S)
    automatically mapped to Pfam PF00621
  5. 2004819Family a.87.1.0: automated matches [233075] (1 protein)
    not a true family
  6. 2004820Protein automated matches [233076] (2 species)
    not a true protein
  7. 2004826Species Mouse (Mus musculus) [TaxId:10090] [234557] (1 PDB entry)
  8. 2004835Domain d4gyvi1: 4gyv I:536-746 [240174]
    Other proteins in same PDB: d4gyva2, d4gyvb2, d4gyvc2, d4gyvd2, d4gyve2, d4gyvf2, d4gyvg2, d4gyvh2, d4gyvi2
    automated match to d4gyvb_

Details for d4gyvi1

PDB Entry: 4gyv (more details), 2.9 Å

PDB Description: crystal structure of the dh domain of farp2
PDB Compounds: (I:) FERM, RhoGEF and pleckstrin domain-containing protein 2

SCOPe Domain Sequences for d4gyvi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gyvi1 a.87.1.0 (I:536-746) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
edeayfiakeilatertylkdlevitvwfrsvlikeeampaalmallfsnidpvyefhrg
flheveqrlalwegpssahlkgdhqrigdillrnmrqlkeftsyfqrhdevltelekatk
hckkleavykefelqkvcylplntfllkpvqrlvhyrlllsrlcahyspghrdyadchea
lkaitevttelqqsltrlenlqkltelqrdl

SCOPe Domain Coordinates for d4gyvi1:

Click to download the PDB-style file with coordinates for d4gyvi1.
(The format of our PDB-style files is described here.)

Timeline for d4gyvi1: