Lineage for d4gyvg_ (4gyv G:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1496671Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
    multihelical; core: 5-helical bundle
  4. 1496672Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families) (S)
    automatically mapped to Pfam PF00621
  5. 1496734Family a.87.1.0: automated matches [233075] (1 protein)
    not a true family
  6. 1496735Protein automated matches [233076] (2 species)
    not a true protein
  7. 1496741Species Mouse (Mus musculus) [TaxId:10090] [234557] (1 PDB entry)
  8. 1496748Domain d4gyvg_: 4gyv G: [240172]
    automated match to d4gyvb_

Details for d4gyvg_

PDB Entry: 4gyv (more details), 2.9 Å

PDB Description: crystal structure of the dh domain of farp2
PDB Compounds: (G:) FERM, RhoGEF and pleckstrin domain-containing protein 2

SCOPe Domain Sequences for d4gyvg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gyvg_ a.87.1.0 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gphmedeayfiakeilatertylkdlevitvwfrsvlikeeampaalmallfsnidpvye
fhrgflheveqrlalwegpssahlkgdhqrigdillrnmrqlkeftsyfqrhdevltele
katkhckkleavykefelqkvcylplntfllkpvqrlvhyrlllsrlcahyspghrdyad
chealkaitevttelqqsltrlenlqkltelqrdl

SCOPe Domain Coordinates for d4gyvg_:

Click to download the PDB-style file with coordinates for d4gyvg_.
(The format of our PDB-style files is described here.)

Timeline for d4gyvg_: