SCOPe 2.08: Domain d4gypd2: 4gyp D:137-445

Lineage for d4gypd2 (4gyp D:137-445)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (79 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [256279] (1 PDB entry)

8. Domain d4gypd2: 4gyp D:137-445 [240169]
   Other proteins in same PDB: d4gypa1, d4gypa2, d4gypb1, d4gypb2, d4gypc1, d4gypd1
   automated match to d3n6ha2
   complexed with cit, gol, mg, p6g, peg, so4

Details for d4gypd2

PDB Entry: 4gyp, 2.1 Å

PDB Description: crystal structure of the heterotetrameric complex of glucd and glucdrp from e. coli k-12 mg1655 (efi target efi-506058)

PDB Compounds: (D:) Glucarate dehydratase-related protein

SCOPe Domain Sequences for d4gypd2:

Sequence; same for both SEQRES and ATOM records:

>d4gypd2 c.1.11.0 (D:137-445) automated matches {Escherichia coli K-12 [TaxId: 83333]}
pgkqreaitvlgylfyigdrtktdlpyventpgnhewyqlrhqkamnseavvrlaeasqd
rygfkdfklkggvlpgeqeidtvralkkrfpdaritvdpngawlldeaislckglndvlt
yaedpcgaeqgfsgrevmaefrratglpvatnmiatnwremghavmlnavdipladphfw
tlsgavrvaqlcddwgltwgchsnnhfdislamfthvgaaapgnptaidthwiwqegdcr
ltqnpleikngkiavpdapglgveldweqvqkaheaykrlpggarndagpmqylipgwtf
drkrpvfgr

Timeline for d4gypd2:

• d4gypd2 first appeared in SCOPe 2.04
  
• d4gypd2 appears in SCOPe 2.07