Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (79 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [256279] (1 PDB entry) |
Domain d4gypd2: 4gyp D:137-445 [240169] Other proteins in same PDB: d4gypa1, d4gypa2, d4gypb1, d4gypb2, d4gypc1, d4gypd1 automated match to d3n6ha2 complexed with cit, gol, mg, p6g, peg, so4 |
PDB Entry: 4gyp (more details), 2.1 Å
SCOPe Domain Sequences for d4gypd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gypd2 c.1.11.0 (D:137-445) automated matches {Escherichia coli K-12 [TaxId: 83333]} pgkqreaitvlgylfyigdrtktdlpyventpgnhewyqlrhqkamnseavvrlaeasqd rygfkdfklkggvlpgeqeidtvralkkrfpdaritvdpngawlldeaislckglndvlt yaedpcgaeqgfsgrevmaefrratglpvatnmiatnwremghavmlnavdipladphfw tlsgavrvaqlcddwgltwgchsnnhfdislamfthvgaaapgnptaidthwiwqegdcr ltqnpleikngkiavpdapglgveldweqvqkaheaykrlpggarndagpmqylipgwtf drkrpvfgr
Timeline for d4gypd2: