Lineage for d4gypd1 (4gyp D:6-136)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1649013Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1649014Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1649263Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1649264Protein automated matches [226922] (67 species)
    not a true protein
  7. 1649442Species Escherichia coli K-12 [TaxId:83333] [256278] (1 PDB entry)
  8. 1649444Domain d4gypd1: 4gyp D:6-136 [240168]
    Other proteins in same PDB: d4gypa1, d4gypa2, d4gypb1, d4gypb2, d4gypc2, d4gypd2
    automated match to d3n6ha1
    complexed with cit, gol, mg, p6g, peg, so4

Details for d4gypd1

PDB Entry: 4gyp (more details), 2.1 Å

PDB Description: crystal structure of the heterotetrameric complex of glucd and glucdrp from e. coli k-12 mg1655 (efi target efi-506058)
PDB Compounds: (D:) Glucarate dehydratase-related protein

SCOPe Domain Sequences for d4gypd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gypd1 d.54.1.0 (D:6-136) automated matches {Escherichia coli K-12 [TaxId: 83333]}
spvitdmkvipvaghdsmllniggahnayftrnivvltdnaghtgigeapggdviyqtlv
daipmvlgqevarlnkvvqqvhkgnqaadfdtfgkgawtfelrvnavaaleaalldllgk
alnvpvcellg

SCOPe Domain Coordinates for d4gypd1:

Click to download the PDB-style file with coordinates for d4gypd1.
(The format of our PDB-style files is described here.)

Timeline for d4gypd1: