![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
![]() | Protein automated matches [226922] (67 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [256278] (1 PDB entry) |
![]() | Domain d4gypd1: 4gyp D:6-136 [240168] Other proteins in same PDB: d4gypa1, d4gypa2, d4gypb1, d4gypb2, d4gypc2, d4gypd2 automated match to d3n6ha1 complexed with cit, gol, mg, p6g, peg, so4 |
PDB Entry: 4gyp (more details), 2.1 Å
SCOPe Domain Sequences for d4gypd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gypd1 d.54.1.0 (D:6-136) automated matches {Escherichia coli K-12 [TaxId: 83333]} spvitdmkvipvaghdsmllniggahnayftrnivvltdnaghtgigeapggdviyqtlv daipmvlgqevarlnkvvqqvhkgnqaadfdtfgkgawtfelrvnavaaleaalldllgk alnvpvcellg
Timeline for d4gypd1: