Lineage for d4gypc1 (4gyp C:6-136)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2170927Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2170928Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2171206Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2171207Protein automated matches [226922] (87 species)
    not a true protein
  7. 2171503Species Escherichia coli K-12 [TaxId:83333] [256278] (1 PDB entry)
  8. 2171504Domain d4gypc1: 4gyp C:6-136 [240166]
    Other proteins in same PDB: d4gypa1, d4gypa2, d4gypb1, d4gypb2, d4gypc2, d4gypd2
    automated match to d3n6ha1
    complexed with cit, gol, mg, p6g, peg, so4

Details for d4gypc1

PDB Entry: 4gyp (more details), 2.1 Å

PDB Description: crystal structure of the heterotetrameric complex of glucd and glucdrp from e. coli k-12 mg1655 (efi target efi-506058)
PDB Compounds: (C:) Glucarate dehydratase-related protein

SCOPe Domain Sequences for d4gypc1:

Sequence, based on SEQRES records: (download)

>d4gypc1 d.54.1.0 (C:6-136) automated matches {Escherichia coli K-12 [TaxId: 83333]}
spvitdmkvipvaghdsmllniggahnayftrnivvltdnaghtgigeapggdviyqtlv
daipmvlgqevarlnkvvqqvhkgnqaadfdtfgkgawtfelrvnavaaleaalldllgk
alnvpvcellg

Sequence, based on observed residues (ATOM records): (download)

>d4gypc1 d.54.1.0 (C:6-136) automated matches {Escherichia coli K-12 [TaxId: 83333]}
spvitdmkvipvaghdsmllniggahnayftrnivvltdnaghtgigeapggdviyqtlv
daipmvlgqevarlnkvvqqvhkgnqelrvnavaaleaalldllgkalnvpvcellg

SCOPe Domain Coordinates for d4gypc1:

Click to download the PDB-style file with coordinates for d4gypc1.
(The format of our PDB-style files is described here.)

Timeline for d4gypc1: