Lineage for d4gxxf_ (4gxx F:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3041028Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)
  8. 3041044Domain d4gxxf_: 4gxx F: [240165]
    Other proteins in same PDB: d4gxxa1, d4gxxa2, d4gxxc_, d4gxxe1, d4gxxe2
    automated match to d1rd8b_
    complexed with nag

Details for d4gxxf_

PDB Entry: 4gxx (more details), 1.8 Å

PDB Description: crystal structure of the "avianized" 1918 influenza virus hemagglutinin
PDB Compounds: (F:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4gxxf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gxxf_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
kvksqlknnakeigngcfefyhkcddacmesvrngtydypkyseesklnre

SCOPe Domain Coordinates for d4gxxf_:

Click to download the PDB-style file with coordinates for d4gxxf_.
(The format of our PDB-style files is described here.)

Timeline for d4gxxf_: