Lineage for d4gmsf_ (4gms F:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3041028Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)
  8. 3041334Domain d4gmsf_: 4gms F: [240160]
    Other proteins in same PDB: d4gmsa1, d4gmsa2, d4gmsc1, d4gmsc2, d4gmse1, d4gmse2, d4gmsh_, d4gmsi_, d4gmsj_, d4gmsl1, d4gmsl2, d4gmsm1, d4gmsn1, d4gmsn2
    automated match to d2viub_
    complexed with gol, nag, pg4, so4

Details for d4gmsf_

PDB Entry: 4gms (more details), 2.95 Å

PDB Description: crystal structure of heterosubtypic fab s139/1 in complex with influenza a h3 hemagglutinin
PDB Compounds: (F:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4gmsf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gmsf_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
gifgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaedmgngcfkiyhkcdnacigsirngtydhdvyrdealnnrf

SCOPe Domain Coordinates for d4gmsf_:

Click to download the PDB-style file with coordinates for d4gmsf_.
(The format of our PDB-style files is described here.)

Timeline for d4gmsf_: