Lineage for d4gmsd_ (4gms D:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2591560Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2591561Protein Influenza hemagglutinin (stalk) [58066] (14 species)
    trimer
  7. 2591653Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)
  8. 2591798Domain d4gmsd_: 4gms D: [240159]
    Other proteins in same PDB: d4gmsa1, d4gmsa2, d4gmsc1, d4gmsc2, d4gmse1, d4gmse2, d4gmsl1, d4gmsl2, d4gmsm1, d4gmsn1, d4gmsn2
    automated match to d2viub_
    complexed with gol, nag, pg4, so4

Details for d4gmsd_

PDB Entry: 4gms (more details), 2.95 Å

PDB Description: Crystal structure of heterosubtypic Fab S139/1 in complex with influenza A H3 hemagglutinin
PDB Compounds: (D:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4gmsd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gmsd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
gifgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaedmgngcfkiyhkcdnacigsirngtydhdvyrdealnnrf

SCOPe Domain Coordinates for d4gmsd_:

Click to download the PDB-style file with coordinates for d4gmsd_.
(The format of our PDB-style files is described here.)

Timeline for d4gmsd_: