Lineage for d4g7hp1 (4g7h P:77-257)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735969Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily)
    multihelical; consists of a conserved 4-helical core and a variable insert subdomain
  4. 2735970Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families) (S)
  5. 2736028Family a.177.1.0: automated matches [254327] (1 protein)
    not a true family
  6. 2736029Protein automated matches [254748] (2 species)
    not a true protein
  7. 2736030Species Thermus thermophilus HB8 [TaxId:300852] [256265] (2 PDB entries)
  8. 2736032Domain d4g7hp1: 4g7h P:77-257 [240149]
    Other proteins in same PDB: d4g7ha1, d4g7ha2, d4g7hb1, d4g7hb2, d4g7hc_, d4g7hd_, d4g7he_, d4g7hf2, d4g7hf3, d4g7hk1, d4g7hk2, d4g7hl1, d4g7hl2, d4g7hm_, d4g7hn_, d4g7ho_, d4g7hp2, d4g7hp3
    automated match to d1smyf3
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d4g7hp1

PDB Entry: 4g7h (more details), 2.9 Å

PDB Description: Crystal structure of Thermus thermophilus transcription initiation complex
PDB Compounds: (P:) RNA polymerase sigma factor

SCOPe Domain Sequences for d4g7hp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g7hp1 a.177.1.0 (P:77-257) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
tsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvrakil
gsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlrlvv
siakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiadqar
t

SCOPe Domain Coordinates for d4g7hp1:

Click to download the PDB-style file with coordinates for d4g7hp1.
(The format of our PDB-style files is described here.)

Timeline for d4g7hp1: