| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) ![]() |
| Family a.4.13.0: automated matches [254211] (1 protein) not a true family |
| Protein automated matches [254475] (4 species) not a true protein |
| Species Thermus thermophilus HB8 [TaxId:300852] [255804] (3 PDB entries) |
| Domain d4g7hf2: 4g7h F:258-318 [240147] Other proteins in same PDB: d4g7ha1, d4g7ha2, d4g7hb1, d4g7hb2, d4g7hc_, d4g7hd_, d4g7he_, d4g7hf1, d4g7hk1, d4g7hk2, d4g7hl1, d4g7hl2, d4g7hm_, d4g7hn_, d4g7ho_, d4g7hp1 automated match to d1smyf1 protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 4g7h (more details), 2.9 Å
SCOPe Domain Sequences for d4g7hf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g7hf2 a.4.13.0 (F:258-318) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
iripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsl
e
Timeline for d4g7hf2: