Lineage for d4fqib1 (4fqi B:1-174)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645407Protein Influenza hemagglutinin (stalk) [58066] (17 species)
    trimer
  7. 2645520Species Influenza A virus, different strains [TaxId:11320] [58067] (131 PDB entries)
  8. 2645521Domain d4fqib1: 4fqi B:1-174 [240144]
    Other proteins in same PDB: d4fqia1, d4fqia2, d4fqib2, d4fqil1, d4fqil2
    automated match to d4n5zb_
    complexed with edo, gol, nag

Details for d4fqib1

PDB Entry: 4fqi (more details), 1.71 Å

PDB Description: crystal structure of fab cr9114 in complex with a h5n1 influenza virus hemagglutinin
PDB Compounds: (B:) hemagglutinin HA2

SCOPe Domain Sequences for d4fqib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fqib1 h.3.1.1 (B:1-174) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeis

SCOPe Domain Coordinates for d4fqib1:

Click to download the PDB-style file with coordinates for d4fqib1.
(The format of our PDB-style files is described here.)

Timeline for d4fqib1: