| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
| Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
| Protein Influenza hemagglutinin (stalk) [58066] (12 species) trimer |
| Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries) |
| Domain d4fqib1: 4fqi B:1-174 [240144] Other proteins in same PDB: d4fqia1, d4fqia2, d4fqib2, d4fqil1, d4fqil2 automated match to d4n5zb_ complexed with edo, gol, nag |
PDB Entry: 4fqi (more details), 1.71 Å
SCOPe Domain Sequences for d4fqib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fqib1 h.3.1.1 (B:1-174) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeis
Timeline for d4fqib1:
View in 3DDomains from other chains: (mouse over for more information) d4fqia1, d4fqia2, d4fqil1, d4fqil2 |