SCOPe 2.05: Domain d4fqib_: 4fqi B:

Lineage for d4fqib_ (4fqi B:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (8 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (109 PDB entries)

8. Domain d4fqib_: 4fqi B: [240144]
   Other proteins in same PDB: d4fqia_, d4fqil1, d4fqil2
   automated match to d4n5zb_
   complexed with edo, gol, nag

Details for d4fqib_

PDB Entry: 4fqi, 1.71 Å

PDB Description: crystal structure of fab cr9114 in complex with a h5n1 influenza virus hemagglutinin

PDB Compounds: (B:) hemagglutinin HA2

SCOPe Domain Sequences for d4fqib_:

Sequence; same for both SEQRES and ATOM records:

>d4fqib_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissg

Timeline for d4fqib_:

• d4fqib_ first appeared in SCOPe 2.04
  
• d4fqib_ is called d4fqib1 in SCOPe 2.06
  
• d4fqib_ appears in the current release, SCOPe 2.08, called d4fqib1