Lineage for d4fnkd_ (4fnk D:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645407Protein Influenza hemagglutinin (stalk) [58066] (17 species)
    trimer
  7. 2645520Species Influenza A virus, different strains [TaxId:11320] [58067] (131 PDB entries)
  8. 2645526Domain d4fnkd_: 4fnk D: [240142]
    Other proteins in same PDB: d4fnka1, d4fnka2, d4fnkc1, d4fnkc2, d4fnke1, d4fnke2
    automated match to d1qfub_
    complexed with gol, nag, so4

Details for d4fnkd_

PDB Entry: 4fnk (more details), 1.9 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin
PDB Compounds: (D:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4fnkd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fnkd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrf

SCOPe Domain Coordinates for d4fnkd_:

Click to download the PDB-style file with coordinates for d4fnkd_.
(The format of our PDB-style files is described here.)

Timeline for d4fnkd_: