Lineage for d4fgwb2 (4fgw B:235-385)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721533Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2721534Protein automated matches [226851] (46 species)
    not a true protein
  7. 2721551Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [234425] (1 PDB entry)
  8. 2721553Domain d4fgwb2: 4fgw B:235-385 [240136]
    Other proteins in same PDB: d4fgwa1, d4fgwb1
    automated match to d4fgwa2

Details for d4fgwb2

PDB Entry: 4fgw (more details), 2.45 Å

PDB Description: Structure of Glycerol-3-Phosphate Dehydrogenase, GPD1, from Sacharomyces Cerevisiae
PDB Compounds: (B:) Glycerol-3-phosphate dehydrogenase [NAD(+)] 1

SCOPe Domain Sequences for d4fgwb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fgwb2 a.100.1.0 (B:235-385) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
vagisicgalknvvalgcgfveglgwgnnasaaiqrvglgeiirfgqmffpesreetyyq
esagvadlittcaggrnvkvarlmatsgkdawecekellngqsaqglitckevhewletc
gsvedfplfeavyqivynnypmknlpdmiee

SCOPe Domain Coordinates for d4fgwb2:

Click to download the PDB-style file with coordinates for d4fgwb2.
(The format of our PDB-style files is described here.)

Timeline for d4fgwb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4fgwb1