SCOPe 2.08: Domain d4fgwb2: 4fgw B:235-385

Lineage for d4fgwb2 (4fgw B:235-385)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (46 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [234425] (1 PDB entry)

8. Domain d4fgwb2: 4fgw B:235-385 [240136]
   Other proteins in same PDB: d4fgwa1, d4fgwb1
   automated match to d4fgwa2

Details for d4fgwb2

PDB Entry: 4fgw, 2.45 Å

PDB Description: Structure of Glycerol-3-Phosphate Dehydrogenase, GPD1, from Sacharomyces Cerevisiae

PDB Compounds: (B:) Glycerol-3-phosphate dehydrogenase [NAD(+)] 1

SCOPe Domain Sequences for d4fgwb2:

Sequence; same for both SEQRES and ATOM records:

>d4fgwb2 a.100.1.0 (B:235-385) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
vagisicgalknvvalgcgfveglgwgnnasaaiqrvglgeiirfgqmffpesreetyyq
esagvadlittcaggrnvkvarlmatsgkdawecekellngqsaqglitckevhewletc
gsvedfplfeavyqivynnypmknlpdmiee

Timeline for d4fgwb2:

• d4fgwb2 first appeared in SCOPe 2.04
  
• d4fgwb2 appears in SCOPe 2.07