Lineage for d4fgwb1 (4fgw B:33-234)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846170Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [232746] (5 PDB entries)
  8. 2846175Domain d4fgwb1: 4fgw B:33-234 [240135]
    Other proteins in same PDB: d4fgwa2, d4fgwb2
    automated match to d4fgwa1

Details for d4fgwb1

PDB Entry: 4fgw (more details), 2.45 Å

PDB Description: Structure of Glycerol-3-Phosphate Dehydrogenase, GPD1, from Sacharomyces Cerevisiae
PDB Compounds: (B:) Glycerol-3-phosphate dehydrogenase [NAD(+)] 1

SCOPe Domain Sequences for d4fgwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fgwb1 c.2.1.0 (B:33-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
kpfkvtvigsgnwgttiakvvaenckgypevfapivqmwvfeeeingeklteiintrhqn
vkylpgitlpdnlvanpdlidsvkdvdiivfniphqflpricsqlkghvdshvraisclk
gfevgakgvqllssyiteelgiqcgalsganiatevaqehwsettvayhipkdfrgegkd
vdhkvlkalfhrpyfhvsvied

SCOPe Domain Coordinates for d4fgwb1:

Click to download the PDB-style file with coordinates for d4fgwb1.
(The format of our PDB-style files is described here.)

Timeline for d4fgwb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4fgwb2