| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.1: Legume lectins [49900] (5 proteins) |
| Protein Concanavalin A [49901] (4 species) natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop |
| Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (74 PDB entries) Uniprot P81461 |
| Domain d1vala_: 1val A: [24013] complexed with ca, mn, png |
PDB Entry: 1val (more details), 3 Å
SCOPe Domain Sequences for d1vala_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vala_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
Timeline for d1vala_: