SCOPe 2.06: Domain d4ewpb1: 4ewp B:2-185

Lineage for d4ewpb1 (4ewp B:2-185)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (60 species)
   not a true protein

7. Species Micrococcus luteus [TaxId:465515] [234402] (1 PDB entry)

8. Domain d4ewpb1: 4ewp B:2-185 [240124]

Details for d4ewpb1

PDB Entry: 4ewp, 2.2 Å

PDB Description: Crystal structure of FabH from Micrococcus luteus

PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase 3

SCOPe Domain Sequences for d4ewpb1:

Sequence; same for both SEQRES and ATOM records:

>d4ewpb1 c.95.1.0 (B:2-185) automated matches {Micrococcus luteus [TaxId: 465515]}
tvtlkqherpaasrivavgayrpanlvpnedligpidssdewirqrtgivtrqrataeet
vpvmavgaarealeraglqgsdldavivstvtfphatpsaaalvaheigatpapaydvsa
acagycygvaqadalvrsgtarhvlvvgverlsdvvdptdrsisfllgdgagavivaasd
epgi

Timeline for d4ewpb1:

• d4ewpb1 first appeared in SCOPe 2.04
  
• d4ewpb1 appears in SCOPe 2.05
  
• d4ewpb1 appears in SCOPe 2.07
  
• d4ewpb1 appears in the current release, SCOPe 2.08