Lineage for d4ewpa2 (4ewp A:186-350)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917783Species Micrococcus luteus [TaxId:465515] [234402] (1 PDB entry)
  8. 2917785Domain d4ewpa2: 4ewp A:186-350 [240123]

Details for d4ewpa2

PDB Entry: 4ewp (more details), 2.2 Å

PDB Description: Crystal structure of FabH from Micrococcus luteus
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 3

SCOPe Domain Sequences for d4ewpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ewpa2 c.95.1.0 (A:186-350) automated matches {Micrococcus luteus [TaxId: 465515]}
spsvwgsdgerwstismthsqlelrdaveharttgdasaitgaegmlwptlrqdgpsvfr
wavwsmakvarealdaagvepedlaafiphqanmriidefakqlklpesvvvardiadag
ntsaasiplamhrlleenpelsgglalqigfgaglvygaqvvrlp

SCOPe Domain Coordinates for d4ewpa2:

Click to download the PDB-style file with coordinates for d4ewpa2.
(The format of our PDB-style files is described here.)

Timeline for d4ewpa2: