![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
![]() | Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) ![]() |
![]() | Family b.74.1.0: automated matches [191576] (1 protein) not a true family |
![]() | Protein automated matches [191011] (13 species) not a true protein |
![]() | Species Vaccinia virus [TaxId:10245] [256246] (6 PDB entries) |
![]() | Domain d4etqc_: 4etq C: [240120] Other proteins in same PDB: d4etqb1, d4etqb2, d4etql1, d4etql2 automated match to d1dmya_ complexed with cl, edo, gol, scn |
PDB Entry: 4etq (more details), 2.1 Å
SCOPe Domain Sequences for d4etqc_:
Sequence, based on SEQRES records: (download)
>d4etqc_ b.74.1.0 (C:) automated matches {Vaccinia virus [TaxId: 10245]} qqlspinietkkaisnarlkpldihyneskpttiqntgklvrinfkggyisggflpneyv lsslhiywgkeddygsnhlidvykysgeinlvhwnkkkyssyeeakkhddgliiisiflq vldhknvyfqkivnqldsirsantsapfdsvfyldnllpskldyftylgttinhsadavw iifptpinihsdqlskfrtllslsnhegkphyitenyrnpyklnddtevyysg
>d4etqc_ b.74.1.0 (C:) automated matches {Vaccinia virus [TaxId: 10245]} qqlspinietkkaisnarlkpldihyneskpttiqntgklvrinfkggyisggflpneyv lsslhiywgkeddygsnhlidvykysgeinlvhwnkkkyssyeeakkhddgliiisiflq vldhknvyfqkivnqldsirsantsapfdsvfyldnllpskldyftylgttinhsadavw iifptpinihsdqlskfrtllslyitenyrnpyklnddtevyysg
Timeline for d4etqc_: