Lineage for d4etqc_ (4etq C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1804997Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 1804998Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 1805718Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 1805719Protein automated matches [191011] (12 species)
    not a true protein
  7. 1805817Species Vaccinia virus [TaxId:10245] [256246] (2 PDB entries)
  8. 1805819Domain d4etqc_: 4etq C: [240120]
    Other proteins in same PDB: d4etqb1, d4etqb2, d4etql1, d4etql2
    automated match to d1dmya_
    complexed with cl, edo, gol, scn

Details for d4etqc_

PDB Entry: 4etq (more details), 2.1 Å

PDB Description: Vaccinia virus D8L IMV envelope protein in complex with Fab of murine IgG2a LA5
PDB Compounds: (C:) IMV membrane protein

SCOPe Domain Sequences for d4etqc_:

Sequence, based on SEQRES records: (download)

>d4etqc_ b.74.1.0 (C:) automated matches {Vaccinia virus [TaxId: 10245]}
qqlspinietkkaisnarlkpldihyneskpttiqntgklvrinfkggyisggflpneyv
lsslhiywgkeddygsnhlidvykysgeinlvhwnkkkyssyeeakkhddgliiisiflq
vldhknvyfqkivnqldsirsantsapfdsvfyldnllpskldyftylgttinhsadavw
iifptpinihsdqlskfrtllslsnhegkphyitenyrnpyklnddtevyysg

Sequence, based on observed residues (ATOM records): (download)

>d4etqc_ b.74.1.0 (C:) automated matches {Vaccinia virus [TaxId: 10245]}
qqlspinietkkaisnarlkpldihyneskpttiqntgklvrinfkggyisggflpneyv
lsslhiywgkeddygsnhlidvykysgeinlvhwnkkkyssyeeakkhddgliiisiflq
vldhknvyfqkivnqldsirsantsapfdsvfyldnllpskldyftylgttinhsadavw
iifptpinihsdqlskfrtllslyitenyrnpyklnddtevyysg

SCOPe Domain Coordinates for d4etqc_:

Click to download the PDB-style file with coordinates for d4etqc_.
(The format of our PDB-style files is described here.)

Timeline for d4etqc_: