SCOP 1.75: Domain d1dq4b_: 1dq4 B:

Lineage for d1dq4b_ (1dq4 B:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Concanavalin A [49901] (2 species)
   natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop

7. Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (52 PDB entries)
   Uniprot P81461

8. Domain d1dq4b_: 1dq4 B: [24012]

Details for d1dq4b_

PDB Entry: 1dq4, 2.9 Å

PDB Description: a transient unlocked concanavalin a structure with mn2+ bound in the transition metal ion binding site s1 and an empty calcium binding site s2

PDB Compounds: (B:) unlocked mn2+ concanavalin a

SCOP Domain Sequences for d1dq4b_:

Sequence, based on SEQRES records:

>d1dq4b_ b.29.1.1 (B:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

Sequence, based on observed residues (ATOM records):

>d1dq4b_ b.29.1.1 (B:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]}
adtivaveldtyppsyphigidiksvrskktakwnmqngkvgtahiiynsvdkrlsavvs
ypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnsthetnal
hfmfnqfskdqkdlilqgdattgtdgnleltrvssvgralfyapvhiwessavvasfeat
ftflikspdshpadgiaffisnidssipsgstgrllglfpdan

Timeline for d1dq4b_:

• d1dq4b_ first appeared (with stable ids) in SCOP 1.55
  
• d1dq4b_ appears in SCOP 1.73
  
• d1dq4b_ appears in SCOPe 2.01
  
• d1dq4b_ appears in the current release, SCOPe 2.08