Lineage for d4emht_ (4emh T:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1786638Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1786639Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1787219Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 1787220Protein automated matches [190914] (10 species)
    not a true protein
  7. 1787349Species Schizosaccharomyces pombe [TaxId:284812] [189773] (4 PDB entries)
  8. 1787368Domain d4emht_: 4emh T: [240114]
    automated match to d4emhb_

Details for d4emht_

PDB Entry: 4emh (more details), 2.2 Å

PDB Description: Crystal structure of SpLsm4
PDB Compounds: (T:) Probable U6 snRNA-associated Sm-like protein LSm4

SCOPe Domain Sequences for d4emht_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4emht_ b.38.1.0 (T:) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
grpilvelkngetfnghlencdnymnltlrevirtmpdgdkffrlpecyirgnnikylri

SCOPe Domain Coordinates for d4emht_:

Click to download the PDB-style file with coordinates for d4emht_.
(The format of our PDB-style files is described here.)

Timeline for d4emht_: