Lineage for d1dq4a_ (1dq4 A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 294476Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 294477Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) (S)
  5. 294478Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 294482Protein Concanavalin A [49901] (2 species)
    natural circle permutation: the "old" N- and C-termini are linked with a peptide bond,whereas the "new" ones correspond to a cleaved loop
  7. 294488Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (45 PDB entries)
  8. 294591Domain d1dq4a_: 1dq4 A: [24011]

Details for d1dq4a_

PDB Entry: 1dq4 (more details), 2.9 Å

PDB Description: a transient unlocked concanavalin a structure with mn2+ bound in the transition metal ion binding site s1 and an empty calcium binding site s2

SCOP Domain Sequences for d1dq4a_:

Sequence, based on SEQRES records: (download)

>d1dq4a_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis)}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

Sequence, based on observed residues (ATOM records): (download)

>d1dq4a_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis)}
adtivaveldtypnpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkrlsavv
sypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnsthetna
lhfmfnqfskdqkdlilqgdattgtdgnleltrvqgssvgralfyapvhiwessavvasf
eatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOP Domain Coordinates for d1dq4a_:

Click to download the PDB-style file with coordinates for d1dq4a_.
(The format of our PDB-style files is described here.)

Timeline for d1dq4a_: