Lineage for d4emhi_ (4emh I:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2396390Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2396391Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2397050Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2397051Protein automated matches [190914] (14 species)
    not a true protein
  7. 2397308Species Schizosaccharomyces pombe [TaxId:284812] [189773] (4 PDB entries)
  8. 2397317Domain d4emhi_: 4emh I: [240104]
    automated match to d4emhb_

Details for d4emhi_

PDB Entry: 4emh (more details), 2.2 Å

PDB Description: Crystal structure of SpLsm4
PDB Compounds: (I:) Probable U6 snRNA-associated Sm-like protein LSm4

SCOPe Domain Sequences for d4emhi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4emhi_ b.38.1.0 (I:) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
grpilvelkngetfnghlencdnymnltlrevirtmpdgdkffrlpecyirgnnikylri

SCOPe Domain Coordinates for d4emhi_:

Click to download the PDB-style file with coordinates for d4emhi_.
(The format of our PDB-style files is described here.)

Timeline for d4emhi_: