Lineage for d4efia1 (4efi A:6-192)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2164457Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2164458Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2165221Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2165222Protein automated matches [196909] (60 species)
    not a true protein
  7. 2165321Species Burkholderia xenovorans [TaxId:266265] [226295] (2 PDB entries)
  8. 2165322Domain d4efia1: 4efi A:6-192 [240099]
    complexed with cl, fmt, unl

Details for d4efia1

PDB Entry: 4efi (more details), 1.35 Å

PDB Description: crystal structure of 3-oxoacyl-(acyl-carrier protein) synthase from burkholderia xenovorans lb400
PDB Compounds: (A:) 3-oxoacyl-(Acyl-carrier protein) synthase

SCOPe Domain Sequences for d4efia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4efia1 c.95.1.0 (A:6-192) automated matches {Burkholderia xenovorans [TaxId: 266265]}
fsagrelrtqgariagvvscvpskqvdndyfverfdasavrdvvkmigvnrrrwadaqts
agdlcrkagekllaglgwqadsidalifvsqtpnyrlpatafvlqaeldlpasclaldin
lgcsgypqalwlgmnliqtgaakrvllavgdtiskmidptdrstsllfgdagtmtalets
ngda

SCOPe Domain Coordinates for d4efia1:

Click to download the PDB-style file with coordinates for d4efia1.
(The format of our PDB-style files is described here.)

Timeline for d4efia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4efia2