SCOPe 2.07: Domain d4edbd_: 4edb D:

Lineage for d4edbd_ (4edb D:)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (17 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (131 PDB entries)

8. Domain d4edbd_: 4edb D: [240095]
   Other proteins in same PDB: d4edba_, d4edbc_, d4edbe_
   automated match to d4n5zb_

Details for d4edbd_

PDB Entry: 4edb, 2.5 Å

PDB Description: structures of monomeric hemagglutinin and its complex with an fab fragment of a neutralizing antibody that binds to h1 subtype influenza viruses: molecular basis of infectivity of 2009 pandemic h1n1 influenza a viruses

PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d4edbd_:

Sequence; same for both SEQRES and ATOM records:

>d4edbd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
tqftavgkefnklerrmenlnkkvddgfidiwtynaellvllenertldfhdsnvknlye
kvksqlknnakeigngcfefyhkcndecmesvkngtydyp

Timeline for d4edbd_:

• d4edbd_ first appeared in SCOPe 2.04
  
• d4edbd_ appears in SCOPe 2.06
  
• d4edbd_ appears in the current release, SCOPe 2.08