SCOPe 2.08: Domain d4edbb_: 4edb B:

Lineage for d4edbb_ (4edb B:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (22 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)

8. Domain d4edbb_: 4edb B: [240094]
   Other proteins in same PDB: d4edba_, d4edbc_, d4edbe_
   automated match to d4n5zb_

Details for d4edbb_

PDB Entry: 4edb, 2.5 Å

PDB Description: structures of monomeric hemagglutinin and its complex with an fab fragment of a neutralizing antibody that binds to h1 subtype influenza viruses: molecular basis of infectivity of 2009 pandemic h1n1 influenza a viruses

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4edbb_:

Sequence; same for both SEQRES and ATOM records:

>d4edbb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
tqftavgkefnklerrmenlnkkvddgfidiwtynaellvllenertldfhdsnvknlye
kvksqlknnakeigngcfefyhkcndecmesvkngtydyp

Timeline for d4edbb_:

• d4edbb_ first appeared in SCOPe 2.04
  
• d4edbb_ appears in SCOPe 2.07