Class a: All alpha proteins [46456] (286 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (57 species) not a true protein |
Species Linum nodiflorum [TaxId:407264] [234362] (3 PDB entries) |
Domain d4e70b1: 4e70 B:993-1112 [240091] Other proteins in same PDB: d4e70a2, d4e70b2 automated match to d4e70a1 complexed with gol, n7i |
PDB Entry: 4e70 (more details), 1.61 Å
SCOPe Domain Sequences for d4e70b1:
Sequence, based on SEQRES records: (download)
>d4e70b1 a.4.5.0 (B:993-1112) automated matches {Linum nodiflorum [TaxId: 407264]} glvprgshmdaatavelldaqpqvwhhflgyinsmtlqcaleldiadvihrhghpiplnq laaaleipqtkapflsrlmrmlvhlgyftqvitkpedenddvlpsywlaplsrlllkqnp
>d4e70b1 a.4.5.0 (B:993-1112) automated matches {Linum nodiflorum [TaxId: 407264]} glvphmdaatavelldaqpqvwhhflgyinsmtlqcaleldiadvihrhghpiplnqlaa aleipqtkapflsrlmrmlvhlgyftqvitkpvlpsywlaplsrlllkqnp
Timeline for d4e70b1: