| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
| Protein automated matches [190154] (92 species) not a true protein |
| Species Linum nodiflorum [TaxId:407264] [234362] (3 PDB entries) |
| Domain d4e70b1: 4e70 B:1000-1112 [240091] Other proteins in same PDB: d4e70a2, d4e70b2, d4e70b3 automated match to d4e70a1 complexed with gol, n7i |
PDB Entry: 4e70 (more details), 1.61 Å
SCOPe Domain Sequences for d4e70b1:
Sequence, based on SEQRES records: (download)
>d4e70b1 a.4.5.0 (B:1000-1112) automated matches {Linum nodiflorum [TaxId: 407264]}
hmdaatavelldaqpqvwhhflgyinsmtlqcaleldiadvihrhghpiplnqlaaalei
pqtkapflsrlmrmlvhlgyftqvitkpedenddvlpsywlaplsrlllkqnp
>d4e70b1 a.4.5.0 (B:1000-1112) automated matches {Linum nodiflorum [TaxId: 407264]}
hmdaatavelldaqpqvwhhflgyinsmtlqcaleldiadvihrhghpiplnqlaaalei
pqtkapflsrlmrmlvhlgyftqvitkpvlpsywlaplsrlllkqnp
Timeline for d4e70b1: