Lineage for d4e70b1 (4e70 B:1000-1112)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694863Species Linum nodiflorum [TaxId:407264] [234362] (3 PDB entries)
  8. 2694865Domain d4e70b1: 4e70 B:1000-1112 [240091]
    Other proteins in same PDB: d4e70a2, d4e70b2, d4e70b3
    automated match to d4e70a1
    complexed with gol, n7i

Details for d4e70b1

PDB Entry: 4e70 (more details), 1.61 Å

PDB Description: Crystal Structure Analysis of Coniferyl Alcohol 9-O-Methyltransferase from Linum Nodiflorum in Complex with Coniferyl Alcohol
PDB Compounds: (B:) Coniferyl alcohol 9-O-methyltransferase

SCOPe Domain Sequences for d4e70b1:

Sequence, based on SEQRES records: (download)

>d4e70b1 a.4.5.0 (B:1000-1112) automated matches {Linum nodiflorum [TaxId: 407264]}
hmdaatavelldaqpqvwhhflgyinsmtlqcaleldiadvihrhghpiplnqlaaalei
pqtkapflsrlmrmlvhlgyftqvitkpedenddvlpsywlaplsrlllkqnp

Sequence, based on observed residues (ATOM records): (download)

>d4e70b1 a.4.5.0 (B:1000-1112) automated matches {Linum nodiflorum [TaxId: 407264]}
hmdaatavelldaqpqvwhhflgyinsmtlqcaleldiadvihrhghpiplnqlaaalei
pqtkapflsrlmrmlvhlgyftqvitkpvlpsywlaplsrlllkqnp

SCOPe Domain Coordinates for d4e70b1:

Click to download the PDB-style file with coordinates for d4e70b1.
(The format of our PDB-style files is described here.)

Timeline for d4e70b1: