Class a: All alpha proteins [46456] (289 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) |
Family a.28.1.0: automated matches [191582] (1 protein) not a true family |
Protein automated matches [191038] (20 species) not a true protein |
Species Staphylococcus aureus [TaxId:93062] [256240] (1 PDB entry) |
Domain d4dxel1: 4dxe L:1-74 [240085] Other proteins in same PDB: d4dxea1, d4dxea2, d4dxeb1, d4dxeb2, d4dxec1, d4dxec2, d4dxed1, d4dxed2, d4dxee1, d4dxee2, d4dxef1, d4dxef2, d4dxeg2, d4dxeh2, d4dxei2, d4dxej2, d4dxek2, d4dxel2 automated match to d3gzmb_ complexed with mli |
PDB Entry: 4dxe (more details), 2.51 Å
SCOPe Domain Sequences for d4dxel1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dxel1 a.28.1.0 (L:1-74) automated matches {Staphylococcus aureus [TaxId: 93062]} menfdkvkdiivdrlgvdadkvtedasfkddlgadsldiaelvmeledefgteipdeeae kintvgdavkfins
Timeline for d4dxel1: